![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
![]() | Domain d5vzrl2: 5vzr L:108-213 [338767] Other proteins in same PDB: d5vzra_, d5vzrb1, d5vzrh_, d5vzrl1 automated match to d1h0da2 complexed with gol |
PDB Entry: 5vzr (more details), 1.57 Å
SCOPe Domain Sequences for d5vzrl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vzrl2 b.1.1.2 (L:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]} rtdaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrne
Timeline for d5vzrl2:
![]() Domains from other chains: (mouse over for more information) d5vzra_, d5vzrb1, d5vzrb2, d5vzrh_ |