SCOPe 2.08: Domain d5vzrb1: 5vzr B:1-107

Lineage for d5vzrb1 (5vzr B:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d5vzrb1: 5vzr B:1-107 [338763]
   Other proteins in same PDB: d5vzra_, d5vzrb2, d5vzrh_, d5vzrl2
   automated match to d1h0da1
   complexed with gol

Details for d5vzrb1

PDB Entry: 5vzr, 1.57 Å

PDB Description: crystal structure of mers-cov neutralizing antibody g4 fab

PDB Compounds: (B:) G4 antibody light chain

SCOPe Domain Sequences for d5vzrb1:

Sequence, based on SEQRES records:

>d5vzrb1 b.1.1.1 (B:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaslavslgqratiscrasesvdnygisfmnwfqqkpgqppkllisatsnqgs
gvparfigsgsgtdfslnihpveeddtamyfcqqskevprtfgggtkleik

Sequence, based on observed residues (ATOM records):

>d5vzrb1 b.1.1.1 (B:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaslavslgqratiscrasesvdnygisfmnwfqqkpgqppkllisaarfigs
gsgtdfslnihpveeddtamyfcqqskevprtfgggtkleik

Timeline for d5vzrb1:

• d5vzrb1 first appeared in SCOPe 2.06
  
• d5vzrb1 appears in SCOPe 2.07