| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) ![]() |
| Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins) dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet |
| Protein Glutamate dehydrogenase [53225] (8 species) |
| Species Thermococcus litoralis [TaxId:2265] [53228] (1 PDB entry) |
| Domain d1bvuc2: 1bvu C:3-180 [33876] Other proteins in same PDB: d1bvua1, d1bvub1, d1bvuc1, d1bvud1, d1bvue1, d1bvuf1 |
PDB Entry: 1bvu (more details), 2.5 Å
SCOPe Domain Sequences for d1bvuc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bvuc2 c.58.1.1 (C:3-180) Glutamate dehydrogenase {Thermococcus litoralis [TaxId: 2265]}
qdpfeiavkqleraaqymdiseealeflkrpqrivevsipvemddgsvkvftgfrvqynw
argptkggirwhpeetlstvkalaawmtwktavmdlpygggkggvicnpkemsdrekerl
argyvraiydvispytdipapdvytnpqimawmmdeyetisrrkdpsfgvitgkppsv
Timeline for d1bvuc2: