Lineage for d1bvub2 (1bvu B:3-180)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25651Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
  4. 25652Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (3 families) (S)
  5. 25653Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
  6. 25654Protein Glutamate dehydrogenase [53225] (5 species)
  7. 25685Species Thermococcus litoralis [TaxId:2265] [53228] (1 PDB entry)
  8. 25687Domain d1bvub2: 1bvu B:3-180 [33875]
    Other proteins in same PDB: d1bvua1, d1bvub1, d1bvuc1, d1bvud1, d1bvue1, d1bvuf1

Details for d1bvub2

PDB Entry: 1bvu (more details), 2.5 Å

PDB Description: glutamate dehydrogenase from thermococcus litoralis

SCOP Domain Sequences for d1bvub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvub2 c.58.1.1 (B:3-180) Glutamate dehydrogenase {Thermococcus litoralis}
qdpfeiavkqleraaqymdiseealeflkrpqrivevsipvemddgsvkvftgfrvqynw
argptkggirwhpeetlstvkalaawmtwktavmdlpygggkggvicnpkemsdrekerl
argyvraiydvispytdipapdvytnpqimawmmdeyetisrrkdpsfgvitgkppsv

SCOP Domain Coordinates for d1bvub2:

Click to download the PDB-style file with coordinates for d1bvub2.
(The format of our PDB-style files is described here.)

Timeline for d1bvub2: