Lineage for d5vi7a2 (5vi7 A:482-617)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2873174Species Zika virus [TaxId:64320] [317810] (28 PDB entries)
  8. 2873202Domain d5vi7a2: 5vi7 A:482-617 [338749]
    Other proteins in same PDB: d5vi7a1, d5vi7a3
    automated match to d2bmfa1
    complexed with so4

Details for d5vi7a2

PDB Entry: 5vi7 (more details), 2.01 Å

PDB Description: crystal structure of the zika virus ns3 helicase
PDB Compounds: (A:) Helicase

SCOPe Domain Sequences for d5vi7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vi7a2 c.37.1.0 (A:482-617) automated matches {Zika virus [TaxId: 64320]}
eghahwlearmlldniylqdgliaslyrpeadkvaaiegefklrteqrktfvelmkrgdl
pvwlayqvasagitytdrrwcfdgttnntimedsvpaevwtkygekrvlkprwmdarvcs
dhaalksfkefaagkr

SCOPe Domain Coordinates for d5vi7a2:

Click to download the PDB-style file with coordinates for d5vi7a2.
(The format of our PDB-style files is described here.)

Timeline for d5vi7a2: