SCOP 1.65: Domain d1gtmc2: 1gtm C:3-180

Lineage for d1gtmc2 (1gtm C:3-180)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families)

5. Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
   dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet

6. Protein Glutamate dehydrogenase [53225] (7 species)

7. Species Archaeon Pyrococcus furiosus [TaxId:2261] [53227] (1 PDB entry)

8. Domain d1gtmc2: 1gtm C:3-180 [33873]
   Other proteins in same PDB: d1gtma1, d1gtmb1, d1gtmc1
   complexed with so4

Details for d1gtmc2

PDB Entry: 1gtm, 2.2 Å

PDB Description: structure of glutamate dehydrogenase

SCOP Domain Sequences for d1gtmc2:

Sequence; same for both SEQRES and ATOM records:

>d1gtmc2 c.58.1.1 (C:3-180) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus}
adpyeivikqleraaqymeiseealeflkrpqrivevtipvemddgsvkvftgfrvqhnw
argptkggirwhpeetlstvkalaawmtwktavmdlpygggkggiivdpkklsdrekerl
argyiraiydvispyedipapdvytnpqimawmmdeyetisrrktpafgiitgkplsi

Timeline for d1gtmc2:

• d1gtmc2 first appeared (with stable ids) in SCOP 1.55
  
• d1gtmc2 appears in SCOP 1.63
  
• d1gtmc2 appears in SCOP 1.67
  
• d1gtmc2 appears in the current release, SCOPe 2.08