![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily) irregular array of 6 short helices |
![]() | Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) ![]() automatically mapped to Pfam PF02807 |
![]() | Family a.83.1.0: automated matches [227170] (1 protein) not a true family |
![]() | Protein automated matches [226884] (9 species) not a true protein |
![]() | Species Polybetes pythagoricus [TaxId:881871] [338673] (2 PDB entries) |
![]() | Domain d5u92a1: 5u92 A:1-95 [338717] Other proteins in same PDB: d5u92a2 automated match to d2j1qa1 complexed with arg, na |
PDB Entry: 5u92 (more details), 2 Å
SCOPe Domain Sequences for d5u92a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u92a1 a.83.1.0 (A:1-95) automated matches {Polybetes pythagoricus [TaxId: 881871]} mvdqatldkleagfkklqdatdcksllkkylnrevfdqckslktalgatlldciqsgven ldsgvgiyapdaeaytlfapifnpiiedyhegfkp
Timeline for d5u92a1: