| Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
| Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) ![]() |
| Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins) dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet |
| Protein Glutamate dehydrogenase [53225] (7 species) |
| Species Archaeon Pyrococcus furiosus [TaxId:2261] [53227] (1 PDB entry) |
| Domain d1gtma2: 1gtm A:3-180 [33871] Other proteins in same PDB: d1gtma1, d1gtmb1, d1gtmc1 |
PDB Entry: 1gtm (more details), 2.2 Å
SCOP Domain Sequences for d1gtma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gtma2 c.58.1.1 (A:3-180) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus}
adpyeivikqleraaqymeiseealeflkrpqrivevtipvemddgsvkvftgfrvqhnw
argptkggirwhpeetlstvkalaawmtwktavmdlpygggkggiivdpkklsdrekerl
argyiraiydvispyedipapdvytnpqimawmmdeyetisrrktpafgiitgkplsi
Timeline for d1gtma2:
View in 3DDomains from other chains: (mouse over for more information) d1gtmb1, d1gtmb2, d1gtmc1, d1gtmc2 |