Lineage for d1gtma2 (1gtm A:3-180)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890284Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 2890285Protein Glutamate dehydrogenase [53225] (8 species)
  7. 2890359Species Pyrococcus furiosus [TaxId:2261] [53227] (1 PDB entry)
  8. 2890360Domain d1gtma2: 1gtm A:3-180 [33871]
    Other proteins in same PDB: d1gtma1, d1gtmb1, d1gtmc1
    complexed with so4

Details for d1gtma2

PDB Entry: 1gtm (more details), 2.2 Å

PDB Description: structure of glutamate dehydrogenase
PDB Compounds: (A:) glutamate dehydrogenase

SCOPe Domain Sequences for d1gtma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtma2 c.58.1.1 (A:3-180) Glutamate dehydrogenase {Pyrococcus furiosus [TaxId: 2261]}
adpyeivikqleraaqymeiseealeflkrpqrivevtipvemddgsvkvftgfrvqhnw
argptkggirwhpeetlstvkalaawmtwktavmdlpygggkggiivdpkklsdrekerl
argyiraiydvispyedipapdvytnpqimawmmdeyetisrrktpafgiitgkplsi

SCOPe Domain Coordinates for d1gtma2:

Click to download the PDB-style file with coordinates for d1gtma2.
(The format of our PDB-style files is described here.)

Timeline for d1gtma2: