Lineage for d5u7oe2 (5u7o E:108-210)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751703Domain d5u7oe2: 5u7o E:108-210 [338708]
    Other proteins in same PDB: d5u7oe1, d5u7oh_, d5u7ol1
    automated match to d2fb4l2
    complexed with 83j, nag, so4

Details for d5u7oe2

PDB Entry: 5u7o (more details), 3.03 Å

PDB Description: crystal structure of hiv-1 bg505 sosip.664 prefusion env trimer bound to small molecule hiv-1 entry inhibitor bms-626529 in complex with human antibodies pgt122 and 35o22 at 3.8 angstrom
PDB Compounds: (E:) 35O22 Fab Light chain

SCOPe Domain Sequences for d5u7oe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u7oe2 b.1.1.2 (E:108-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qskanpsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapte

SCOPe Domain Coordinates for d5u7oe2:

Click to download the PDB-style file with coordinates for d5u7oe2.
(The format of our PDB-style files is described here.)

Timeline for d5u7oe2: