![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.2: Thermolysin-like [55490] (5 proteins) includes alpha-helical C-terminal domain characteristic for the family |
![]() | Protein Thermolysin [63414] (3 species) |
![]() | Species Bacillus thermoproteolyticus [TaxId:1427] [55494] (191 PDB entries) Uniprot P00800 |
![]() | Domain d5t9qa_: 5t9q A: [338706] automated match to d1kkka_ complexed with ca, lys, po4, val, zn |
PDB Entry: 5t9q (more details), 2.1 Å
SCOPe Domain Sequences for d5t9qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t9qa_ d.92.1.2 (A:) Thermolysin {Bacillus thermoproteolyticus [TaxId: 1427]} itgtstvgvgrgvlgdqkninttystyyylqdntrgngiftydakyrttlpgslwadadn qffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsqm vygdgdgqtfiplsggidvvahelthavtdytagliyqnesgaineaisdifgtlvefya nknpdweigedvytpgisgdslrsmsdpakygdpdhyskrytgtqdnggvhinsgiinka aylisqggthygvsvvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygsts qevasvkqafdavgvk
Timeline for d5t9qa_: