Lineage for d5t9qa_ (5t9q A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2963595Family d.92.1.2: Thermolysin-like [55490] (5 proteins)
    includes alpha-helical C-terminal domain characteristic for the family
  6. 2963611Protein Thermolysin [63414] (3 species)
  7. 2963612Species Bacillus thermoproteolyticus [TaxId:1427] [55494] (191 PDB entries)
    Uniprot P00800
  8. 2963782Domain d5t9qa_: 5t9q A: [338706]
    automated match to d1kkka_
    complexed with ca, lys, po4, val, zn

Details for d5t9qa_

PDB Entry: 5t9q (more details), 2.1 Å

PDB Description: conformational sampling differences across the arrhenius plot biphasic break point at ambient temperature in the enzyme thermolysin
PDB Compounds: (A:) thermolysin

SCOPe Domain Sequences for d5t9qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t9qa_ d.92.1.2 (A:) Thermolysin {Bacillus thermoproteolyticus [TaxId: 1427]}
itgtstvgvgrgvlgdqkninttystyyylqdntrgngiftydakyrttlpgslwadadn
qffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsqm
vygdgdgqtfiplsggidvvahelthavtdytagliyqnesgaineaisdifgtlvefya
nknpdweigedvytpgisgdslrsmsdpakygdpdhyskrytgtqdnggvhinsgiinka
aylisqggthygvsvvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygsts
qevasvkqafdavgvk

SCOPe Domain Coordinates for d5t9qa_:

Click to download the PDB-style file with coordinates for d5t9qa_.
(The format of our PDB-style files is described here.)

Timeline for d5t9qa_: