SCOPe 2.08: Domain d5v3da_: 5v3d A:

Lineage for d5v3da_ (5v3d A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (26 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [338697] (3 PDB entries)

8. Domain d5v3da_: 5v3d A: [338701]
   automated match to d4jh2a_
   complexed with edo, fcn, k, mn, peg

Details for d5v3da_

PDB Entry: 5v3d, 1.54 Å

PDB Description: crystal structure of fosfomycin resistance protein from klebsiella pneumoniae with bound fosfomycin

PDB Compounds: (A:) Fosfomycin resistance protein

SCOPe Domain Sequences for d5v3da_:

Sequence; same for both SEQRES and ATOM records:

>d5v3da_ d.32.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
mlsglnhltlavsqlapsvafyqqllgmtlharwdsgaylscgdlwlclsldpqrrvtpp
eesdythyafsiseadfasfaarleaagvavwklnrsegashyfldpdghklelhvgsla
qrlaacreqpykgmvffe

Timeline for d5v3da_:

• d5v3da_ first appeared in SCOPe 2.06
  
• d5v3da_ appears in SCOPe 2.07