Lineage for d5ue9b1 (5ue9 B:1-102)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2385975Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2386485Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2386687Family b.43.4.0: automated matches [227162] (1 protein)
    not a true family
  6. 2386688Protein automated matches [226870] (21 species)
    not a true protein
  7. 2386729Species Lactococcus lactis [TaxId:1360] [320608] (2 PDB entries)
  8. 2386732Domain d5ue9b1: 5ue9 B:1-102 [338699]
    Other proteins in same PDB: d5ue9a_, d5ue9b2, d5ue9c_, d5ue9d2
    automated match to d1ep3b1
    complexed with cl, fad, fes, fmn, gol, oro

Details for d5ue9b1

PDB Entry: 5ue9 (more details), 2.72 Å

PDB Description: wt dhodb with orotate bound
PDB Compounds: (B:) Dihydroorotate dehydrogenase B (NAD(+)), electron transfer subunit

SCOPe Domain Sequences for d5ue9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ue9b1 b.43.4.0 (B:1-102) automated matches {Lactococcus lactis [TaxId: 1360]}
mpklqemmtivsqrevasnifemvlkgelveemdlpgqflhlavpnasmllrrpisissw
dkvaktctilyrigdetsgtyeisklqsgakidvmgplgngf

SCOPe Domain Coordinates for d5ue9b1:

Click to download the PDB-style file with coordinates for d5ue9b1.
(The format of our PDB-style files is described here.)

Timeline for d5ue9b1: