SCOPe 2.08: Domain d5u7ml1: 5u7m L:8-106

Lineage for d5u7ml1 (5u7m L:8-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5u7ml1: 5u7m L:8-106 [338691]
   Other proteins in same PDB: d5u7me2, d5u7ml2
   automated match to d4ocrl1
   complexed with 83g, nag, so4

Details for d5u7ml1

PDB Entry: 5u7m, 3.03 Å

PDB Description: crystal structure of hiv-1 bg505 sosip.664 prefusion env trimer bound to small molecule hiv-1 entry inhibitor bms-378806 in complex with human antibodies pgt122 and 35o22 at 3.8 angstrom

PDB Compounds: (L:) PGT122 Fab light chain

SCOPe Domain Sequences for d5u7ml1:

Sequence; same for both SEQRES and ATOM records:

>d5u7ml1 b.1.1.0 (L:8-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tfvsvapgqtaritcgeeslgsrsviwyqqrpgqapsliiynnndrpsgipdrfsgspgs
tfgttatltitsveagdeadyychiwdsrrptnwvfgegttliv

Timeline for d5u7ml1:

• d5u7ml1 first appeared in SCOPe 2.06
  
• d5u7ml1 appears in SCOPe 2.07