Lineage for d1hrdb2 (1hrd B:1-194)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1376891Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 1376892Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 1376893Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 1376894Protein Glutamate dehydrogenase [53225] (8 species)
  7. 1376895Species Clostridium symbiosum [TaxId:1512] [53226] (4 PDB entries)
  8. 1376899Domain d1hrdb2: 1hrd B:1-194 [33868]
    Other proteins in same PDB: d1hrda1, d1hrdb1, d1hrdc1

Details for d1hrdb2

PDB Entry: 1hrd (more details), 1.96 Å

PDB Description: glutamate dehydrogenase
PDB Compounds: (B:) glutamate dehydrogenase

SCOPe Domain Sequences for d1hrdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hrdb2 c.58.1.1 (B:1-194) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]}
skyvdrviaevekkyadepefvqtveevlsslgpvvdahpeyeevallermvipervief
rvpweddngkvhvntgyrvqfngaigpykgglrfapsvnlsimkflgfeqafkdslttlp
mggakggsdfdpngksdrevmrfcqafmtelyrhigpdidvpagdlgvgareigymygqy
rkivggfyngvltg

SCOPe Domain Coordinates for d1hrdb2:

Click to download the PDB-style file with coordinates for d1hrdb2.
(The format of our PDB-style files is described here.)

Timeline for d1hrdb2: