![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily) duplication: common core consists of two beta-alpha-beta2-alpha repeats |
![]() | Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) ![]() |
![]() | Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins) automatically mapped to Pfam PF00217 |
![]() | Protein automated matches [226885] (7 species) not a true protein |
![]() | Species Polybetes pythagoricus [TaxId:881871] [338675] (2 PDB entries) |
![]() | Domain d5u8ea2: 5u8e A:96-357 [338676] Other proteins in same PDB: d5u8ea1 automated match to d2j1qa2 complexed with na |
PDB Entry: 5u8e (more details), 2.18 Å
SCOPe Domain Sequences for d5u8ea2:
Sequence, based on SEQRES records: (download)
>d5u8ea2 d.128.1.2 (A:96-357) automated matches {Polybetes pythagoricus [TaxId: 881871]} tdkhpptdfgdintivnvdpsgkyvvsthvrcgrslkgypfnpclteanykemedkvsai fgtfegelkgkyypltgmdkatqqqliddhflfkegdrflqaanacrywptgrgiyhnda ktflvwvneedhlriismqkggdlktifqrlvnavntiesklpfsrddrlgfltfcptnl gttirasvhialpklakdkkqleaiaakfnlqvrgtrgehteseggvydisnkrrmglte yqavkemqdgilemikmeeaap
>d5u8ea2 d.128.1.2 (A:96-357) automated matches {Polybetes pythagoricus [TaxId: 881871]} tdkhpptdfgdintivnvdpsgkyvvsthvrcgrslkgypfnpclteanykemedkvsai fgtfegelkgkyypltgmdkatqqqliddhflfkegdrflqaanacrywptgrgiyhnda ktflvwvneedhlriismqkggdlktifqrlvnavntiesklpfsrddrlgfltfcptnl gttirasvhialpklakdkkqleaiaakfnlqvrggvydisnkrrmglteyqavkemqdg ilemikmeeaap
Timeline for d5u8ea2: