Lineage for d5u8ea2 (5u8e A:96-357)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214217Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2214218Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2214351Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins)
    automatically mapped to Pfam PF00217
  6. 2214415Protein automated matches [226885] (5 species)
    not a true protein
  7. 2214439Species Polybetes pythagoricus [TaxId:881871] [338675] (2 PDB entries)
  8. 2214441Domain d5u8ea2: 5u8e A:96-357 [338676]
    Other proteins in same PDB: d5u8ea1
    automated match to d2j1qa2
    complexed with na

Details for d5u8ea2

PDB Entry: 5u8e (more details), 2.18 Å

PDB Description: crystal structure of substrate-free arginine kinase from spider polybetes pythagoricus
PDB Compounds: (A:) arginine kinase

SCOPe Domain Sequences for d5u8ea2:

Sequence, based on SEQRES records: (download)

>d5u8ea2 d.128.1.2 (A:96-357) automated matches {Polybetes pythagoricus [TaxId: 881871]}
tdkhpptdfgdintivnvdpsgkyvvsthvrcgrslkgypfnpclteanykemedkvsai
fgtfegelkgkyypltgmdkatqqqliddhflfkegdrflqaanacrywptgrgiyhnda
ktflvwvneedhlriismqkggdlktifqrlvnavntiesklpfsrddrlgfltfcptnl
gttirasvhialpklakdkkqleaiaakfnlqvrgtrgehteseggvydisnkrrmglte
yqavkemqdgilemikmeeaap

Sequence, based on observed residues (ATOM records): (download)

>d5u8ea2 d.128.1.2 (A:96-357) automated matches {Polybetes pythagoricus [TaxId: 881871]}
tdkhpptdfgdintivnvdpsgkyvvsthvrcgrslkgypfnpclteanykemedkvsai
fgtfegelkgkyypltgmdkatqqqliddhflfkegdrflqaanacrywptgrgiyhnda
ktflvwvneedhlriismqkggdlktifqrlvnavntiesklpfsrddrlgfltfcptnl
gttirasvhialpklakdkkqleaiaakfnlqvrggvydisnkrrmglteyqavkemqdg
ilemikmeeaap

SCOPe Domain Coordinates for d5u8ea2:

Click to download the PDB-style file with coordinates for d5u8ea2.
(The format of our PDB-style files is described here.)

Timeline for d5u8ea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5u8ea1