SCOPe 2.08: Domain d5u8ea1: 5u8e A:1-95

Lineage for d5u8ea1 (5u8e A:1-95)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
   irregular array of 6 short helices

4. Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families)
   automatically mapped to Pfam PF02807

5. Family a.83.1.0: automated matches [227170] (1 protein)
   not a true family

6. Protein automated matches [226884] (9 species)
   not a true protein

7. Species Polybetes pythagoricus [TaxId:881871] [338673] (2 PDB entries)

8. Domain d5u8ea1: 5u8e A:1-95 [338674]
   Other proteins in same PDB: d5u8ea2
   automated match to d2j1qa1
   complexed with na

Details for d5u8ea1

PDB Entry: 5u8e, 2.18 Å

PDB Description: crystal structure of substrate-free arginine kinase from spider polybetes pythagoricus

PDB Compounds: (A:) arginine kinase

SCOPe Domain Sequences for d5u8ea1:

Sequence; same for both SEQRES and ATOM records:

>d5u8ea1 a.83.1.0 (A:1-95) automated matches {Polybetes pythagoricus [TaxId: 881871]}
mvdqatldkleagfkklqdatdcksllkkylnrevfdqckslktalgatlldciqsgven
ldsgvgiyapdaeaytlfapifnpiiedyhegfkp

Timeline for d5u8ea1:

• d5u8ea1 first appeared in SCOPe 2.06
  
• d5u8ea1 appears in SCOPe 2.07