Lineage for d1di6a_ (1di6 A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) (S)
  5. Family c.57.1.1: MogA-like [53219] (6 proteins)
  6. Protein MogA [53220] (3 species)
  7. Species Escherichia coli [TaxId:562] [53221] (2 PDB entries)
  8. Domain d1di6a_: 1di6 A: [33863]
    complexed with so4

Details for d1di6a_

PDB Entry: 1di6 (more details), 1.45 Å

PDB Description: 1.45 a crystal structure of the molybdenumm cofactor biosynthesis protein moga from escherichia coli
PDB Compounds: (A:) molybdenum cofactor biosynthetic enzyme

SCOPe Domain Sequences for d1di6a_:

Sequence, based on SEQRES records: (download)

>d1di6a_ c.57.1.1 (A:) MogA {Escherichia coli [TaxId: 562]}
atlriglvsisdrassgvyqdkgipaleewltsalttpfeletrlipdeqaiieqtlcel
vdemschlvlttggtgparrdvtpdatlavadrempgfgeqmrqislhfvptailsrqvg
virkqalilnlpgqpksiketlegvkdaegnvvvhgifasvpyciqllegpyvetapevv
aafrpksarr

Sequence, based on observed residues (ATOM records): (download)

>d1di6a_ c.57.1.1 (A:) MogA {Escherichia coli [TaxId: 562]}
atlriglvsisdrdkgipaleewltsalttpfeletrlipdeqaiieqtlcelvdemsch
lvlttggtgparrdvtpdatlavadrempgfgeqmrqislhfvptailsrqvgvirkqal
ilnlpgqpksiketlegvkdaegnvvvhgifasvpyciqllegpyvetapevvaafrpks
arr

SCOPe Domain Coordinates for d1di6a_ are not available.

Timeline for d1di6a_: