Lineage for d1b4ud_ (1b4u D:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25480Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
  4. 25636Superfamily c.56.6: LigB subunit of an aromatic-ring-opening dioxygenase LigAB [53213] (1 family) (S)
  5. 25637Family c.56.6.1: LigB subunit of an aromatic-ring-opening dioxygenase LigAB [53214] (1 protein)
  6. 25638Protein LigB subunit of an aromatic-ring-opening dioxygenase LigAB [53215] (1 species)
  7. 25639Species Pseudomonas paucimobilis [TaxId:13689] [53216] (2 PDB entries)
  8. 25643Domain d1b4ud_: 1b4u D: [33862]
    Other proteins in same PDB: d1b4ua_, d1b4uc_

Details for d1b4ud_

PDB Entry: 1b4u (more details), 2.2 Å

PDB Description: protocatechuate 4,5-dioxygenase (ligab) in complex with protocatechuate (pca)

SCOP Domain Sequences for d1b4ud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b4ud_ c.56.6.1 (D:) LigB subunit of an aromatic-ring-opening dioxygenase LigAB {Pseudomonas paucimobilis}
arvttgitsshipalgaaiqtgtsdndywgpvfkgyqpirdwikqpgnmpdvvilvyndh
asafdmniiptfaigcaetfkpadegwgprpvpdvkghpdlawhiaqslildefdmtimn
qmdvdhgctvplsmifgepeewpckvipfpvnvvtypppsgkrcfalgdsiraavesfpe
dlnvhvwgtggmshqlqgpraglinkefdlnfidklisdpeelskmphiqylresgsegv
elvmwlimrgalpekvrdlytfyhipasntalgamilqpeetagtpleprkvmsghsl

SCOP Domain Coordinates for d1b4ud_:

Click to download the PDB-style file with coordinates for d1b4ud_.
(The format of our PDB-style files is described here.)

Timeline for d1b4ud_: