| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.6: LigB-like [53213] (1 family) ![]() circular permutation of the common fold, most similar to the PNP fold automatically mapped to Pfam PF02900 |
| Family c.56.6.1: LigB-like [53214] (2 proteins) |
| Protein LigB subunit of an aromatic-ring-opening dioxygenase LigAB [53215] (1 species) |
| Species Pseudomonas paucimobilis [TaxId:13689] [53216] (2 PDB entries) |
| Domain d1b4ub_: 1b4u B: [33861] Other proteins in same PDB: d1b4ua_, d1b4uc_ complexed with dhb, fe |
PDB Entry: 1b4u (more details), 2.2 Å
SCOPe Domain Sequences for d1b4ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b4ub_ c.56.6.1 (B:) LigB subunit of an aromatic-ring-opening dioxygenase LigAB {Pseudomonas paucimobilis [TaxId: 13689]}
arvttgitsshipalgaaiqtgtsdndywgpvfkgyqpirdwikqpgnmpdvvilvyndh
asafdmniiptfaigcaetfkpadegwgprpvpdvkghpdlawhiaqslildefdmtimn
qmdvdhgctvplsmifgepeewpckvipfpvnvvtypppsgkrcfalgdsiraavesfpe
dlnvhvwgtggmshqlqgpraglinkefdlnfidklisdpeelskmphiqylresgsegv
elvmwlimrgalpekvrdlytfyhipasntalgamilqpeetagtpleprkvmsghsl
Timeline for d1b4ub_: