SCOPe 2.08: Domain d1b4ub_: 1b4u B:

Lineage for d1b4ub_ (1b4u B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.6: LigB-like [53213] (1 family)
   circular permutation of the common fold, most similar to the PNP fold
   automatically mapped to Pfam PF02900

5. Family c.56.6.1: LigB-like [53214] (2 proteins)

6. Protein LigB subunit of an aromatic-ring-opening dioxygenase LigAB [53215] (1 species)

7. Species Pseudomonas paucimobilis [TaxId:13689] [53216] (2 PDB entries)

8. Domain d1b4ub_: 1b4u B: [33861]
   Other proteins in same PDB: d1b4ua_, d1b4uc_
   complexed with dhb, fe

Details for d1b4ub_

PDB Entry: 1b4u, 2.2 Å

PDB Description: protocatechuate 4,5-dioxygenase (ligab) in complex with protocatechuate (pca)

PDB Compounds: (B:) protocatechuate 4,5-dioxygenase

SCOPe Domain Sequences for d1b4ub_:

Sequence; same for both SEQRES and ATOM records:

>d1b4ub_ c.56.6.1 (B:) LigB subunit of an aromatic-ring-opening dioxygenase LigAB {Pseudomonas paucimobilis [TaxId: 13689]}
arvttgitsshipalgaaiqtgtsdndywgpvfkgyqpirdwikqpgnmpdvvilvyndh
asafdmniiptfaigcaetfkpadegwgprpvpdvkghpdlawhiaqslildefdmtimn
qmdvdhgctvplsmifgepeewpckvipfpvnvvtypppsgkrcfalgdsiraavesfpe
dlnvhvwgtggmshqlqgpraglinkefdlnfidklisdpeelskmphiqylresgsegv
elvmwlimrgalpekvrdlytfyhipasntalgamilqpeetagtpleprkvmsghsl

Timeline for d1b4ub_:

• d1b4ub_ first appeared (with stable ids) in SCOP 1.55
  
• d1b4ub_ appears in SCOPe 2.07