SCOPe 2.08: Domain d5ov5a1: 5ov5 A:1-218

Lineage for d5ov5a1 (5ov5 A:1-218)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Bacillus megaterium [TaxId:1404] [238213] (5 PDB entries)

8. Domain d5ov5a1: 5ov5 A:1-218 [338603]
   Other proteins in same PDB: d5ov5a2, d5ov5a3
   automated match to d4mlva1
   complexed with dpm; mutant

Details for d5ov5a1

PDB Entry: 5ov5, 1.81 Å

PDB Description: bacillus megaterium porphobilinogen deaminase d82e mutant

PDB Compounds: (A:) porphobilinogen deaminase

SCOPe Domain Sequences for d5ov5a1:

Sequence, based on SEQRES records:

>d5ov5a1 c.94.1.0 (A:1-218) automated matches {Bacillus megaterium [TaxId: 1404]}
mrkiivgsrrsklaltqtkwvieqlkkqglpfefeikemvtkgdqilnvtlskvggkglf
vkeieqamldkeidmavhsmkempavlpegltigciplredhrdaliskngerfeelpsg
avigtsslrrgaqllsmrsdieikwirgnidtrleklknedydaiilaaaglsrmgwskd
tvtqylepeisvpavgqgalaiecrendhellsllqal

Sequence, based on observed residues (ATOM records):

>d5ov5a1 c.94.1.0 (A:1-218) automated matches {Bacillus megaterium [TaxId: 1404]}
mrkiivgsrrsklaltqtkwvieqlkkqglpfefeikemfvkeieqamldkeidmavhsm
kempavlpegltigciplredhrdaliskngerfeelpsgavigtsslrrgaqllsmrsd
ieikwirgnidtrleklknedydaiilaaaglsrmgwskdtvtqylepeisvpavgqgal
aiecrendhellsllqal

Timeline for d5ov5a1:

• d5ov5a1 first appeared in SCOPe 2.06
  
• d5ov5a1 appears in SCOPe 2.07