Lineage for d5oq4a2 (5oq4 A:357-522)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2772795Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) (S)
    two constituent families are related by circular permutation
  5. 2772796Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins)
  6. 2772819Protein Phoshoinositide 3-kinase (PI3K) [49570] (2 species)
  7. 2772820Species Human (Homo sapiens) [TaxId:9606] [49572] (70 PDB entries)
  8. 2772873Domain d5oq4a2: 5oq4 A:357-522 [338600]
    Other proteins in same PDB: d5oq4a1, d5oq4a3, d5oq4a4
    automated match to d1e8za2
    complexed with a3w, so4

Details for d5oq4a2

PDB Entry: 5oq4 (more details), 2.7 Å

PDB Description: pqr309 - a potent, brain-penetrant, orally bioavailable, pan-class i pi3k/mtor inhibitor as clinical candidate in oncology
PDB Compounds: (A:) Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d5oq4a2:

Sequence, based on SEQRES records: (download)

>d5oq4a2 b.7.1.1 (A:357-522) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
cdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlef
sikikdlpkgallnlqiycgkapalsskasaespsseskgkvrllyyvnlllidhrfllr
rgeyvlhmwqisgkgedqgsfnadkltsatnpdkensmsisilldn

Sequence, based on observed residues (ATOM records): (download)

>d5oq4a2 b.7.1.1 (A:357-522) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
cdrkfrvkirgidipvlntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsi
kikdlpkgallnlqiycrllyyvnlllidhrfllrrgeyvlhmwqisgfnadkltsatnp
dkensmsisilldn

SCOPe Domain Coordinates for d5oq4a2:

Click to download the PDB-style file with coordinates for d5oq4a2.
(The format of our PDB-style files is described here.)

Timeline for d5oq4a2: