Lineage for d5oq4a1 (5oq4 A:145-321)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2502429Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins)
    contains Pfam PF00788 and Pfam PF02196
  6. 2502449Protein Phoshoinositide 3-kinase (PI3K) [54274] (2 species)
    includes parts of the flanking linkers
  7. 2502450Species Human (Homo sapiens) [TaxId:9606] [54276] (71 PDB entries)
  8. 2502500Domain d5oq4a1: 5oq4 A:145-321 [338599]
    Other proteins in same PDB: d5oq4a2, d5oq4a3, d5oq4a4
    automated match to d1e8za3
    complexed with a3w, so4

Details for d5oq4a1

PDB Entry: 5oq4 (more details), 2.7 Å

PDB Description: pqr309 - a potent, brain-penetrant, orally bioavailable, pan-class i pi3k/mtor inhibitor as clinical candidate in oncology
PDB Compounds: (A:) Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d5oq4a1:

Sequence, based on SEQRES records: (download)

>d5oq4a1 d.15.1.5 (A:145-321) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
eesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvts
kplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdipes
qseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrke

Sequence, based on observed residues (ATOM records): (download)

>d5oq4a1 d.15.1.5 (A:145-321) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
eesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvts
kplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkqdfvlrvcgrdey
lvgetpiknfqwvrhclkngeeihvvldtppdpaldevrke

SCOPe Domain Coordinates for d5oq4a1:

Click to download the PDB-style file with coordinates for d5oq4a1.
(The format of our PDB-style files is described here.)

Timeline for d5oq4a1: