Lineage for d1boub_ (1bou B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 72307Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
  4. 72486Superfamily c.56.6: LigB subunit of an aromatic-ring-opening dioxygenase LigAB [53213] (1 family) (S)
  5. 72487Family c.56.6.1: LigB subunit of an aromatic-ring-opening dioxygenase LigAB [53214] (1 protein)
  6. 72488Protein LigB subunit of an aromatic-ring-opening dioxygenase LigAB [53215] (1 species)
  7. 72489Species Pseudomonas paucimobilis [TaxId:13689] [53216] (2 PDB entries)
  8. 72490Domain d1boub_: 1bou B: [33859]
    Other proteins in same PDB: d1boua_, d1bouc_

Details for d1boub_

PDB Entry: 1bou (more details), 2.2 Å

PDB Description: three-dimensional structure of ligab

SCOP Domain Sequences for d1boub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1boub_ c.56.6.1 (B:) LigB subunit of an aromatic-ring-opening dioxygenase LigAB {Pseudomonas paucimobilis}
arvttgitsshipalgaaiqtgtsdndywgpvfkgyqpirdwikqpgnmpdvvilvyndh
asafdmniiptfaigcaetfkpadegwgprpvpdvkghpdlawhiaqslildefdmtimn
qmdvdhgctvplsmifgepeewpckvipfpvnvvtypppsgkrcfalgdsiraavesfpe
dlnvhvwgtggmshqlqgpraglinkefdlnfidklisdpeelskmphiqylresgsegv
elvmwlimrgalpekvrdlytfyhipasntalgamilqpeetagtpleprkvmsghsl

SCOP Domain Coordinates for d1boub_:

Click to download the PDB-style file with coordinates for d1boub_.
(The format of our PDB-style files is described here.)

Timeline for d1boub_: