Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies) |
Superfamily c.56.6: LigB subunit of an aromatic-ring-opening dioxygenase LigAB [53213] (1 family) |
Family c.56.6.1: LigB subunit of an aromatic-ring-opening dioxygenase LigAB [53214] (1 protein) |
Protein LigB subunit of an aromatic-ring-opening dioxygenase LigAB [53215] (1 species) |
Species Pseudomonas paucimobilis [TaxId:13689] [53216] (2 PDB entries) |
Domain d1boub_: 1bou B: [33859] Other proteins in same PDB: d1boua_, d1bouc_ |
PDB Entry: 1bou (more details), 2.2 Å
SCOP Domain Sequences for d1boub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1boub_ c.56.6.1 (B:) LigB subunit of an aromatic-ring-opening dioxygenase LigAB {Pseudomonas paucimobilis} arvttgitsshipalgaaiqtgtsdndywgpvfkgyqpirdwikqpgnmpdvvilvyndh asafdmniiptfaigcaetfkpadegwgprpvpdvkghpdlawhiaqslildefdmtimn qmdvdhgctvplsmifgepeewpckvipfpvnvvtypppsgkrcfalgdsiraavesfpe dlnvhvwgtggmshqlqgpraglinkefdlnfidklisdpeelskmphiqylresgsegv elvmwlimrgalpekvrdlytfyhipasntalgamilqpeetagtpleprkvmsghsl
Timeline for d1boub_: