Class g: Small proteins [56992] (98 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) |
Family g.17.1.6: Interleukin 17F, IL-17F [69955] (2 proteins) |
Protein automated matches [338587] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [338588] (3 PDB entries) |
Domain d5n92f_: 5n92 F: [338589] automated match to d1jpyy_ complexed with fuc, nag |
PDB Entry: 5n92 (more details), 2.3 Å
SCOPe Domain Sequences for d5n92f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n92f_ g.17.1.6 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pescppvpggsmkldigiinenqrvsmsrniesrstspwnytvtwdpnrypsevvqaqcr nlgcinaqgkedismnsvpiqqetlvvrrkhqgcsvsfqlekvlvtvgctcvtpvihhvq
Timeline for d5n92f_: