Lineage for d5n92f_ (5n92 F:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638316Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2638317Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2638648Family g.17.1.6: Interleukin 17F, IL-17F [69955] (2 proteins)
  6. 2638655Protein automated matches [338587] (1 species)
    not a true protein
  7. 2638656Species Human (Homo sapiens) [TaxId:9606] [338588] (3 PDB entries)
  8. 2638661Domain d5n92f_: 5n92 F: [338589]
    automated match to d1jpyy_
    complexed with fuc, nag

Details for d5n92f_

PDB Entry: 5n92 (more details), 2.3 Å

PDB Description: crystal structure of human il-17af
PDB Compounds: (F:) Interleukin-17F

SCOPe Domain Sequences for d5n92f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n92f_ g.17.1.6 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pescppvpggsmkldigiinenqrvsmsrniesrstspwnytvtwdpnrypsevvqaqcr
nlgcinaqgkedismnsvpiqqetlvvrrkhqgcsvsfqlekvlvtvgctcvtpvihhvq

SCOPe Domain Coordinates for d5n92f_:

Click to download the PDB-style file with coordinates for d5n92f_.
(The format of our PDB-style files is described here.)

Timeline for d5n92f_: