Lineage for d5m2ii_ (5m2i I:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2743956Domain d5m2ii_: 5m2i I: [338575]
    Other proteins in same PDB: d5m2ia_, d5m2ib_, d5m2ic_, d5m2id_, d5m2ie_, d5m2if_
    automated match to d4dkaa_

Details for d5m2ii_

PDB Entry: 5m2i (more details), 2.15 Å

PDB Description: structure of human tumor necrosis factor (tnf) in complex with the llama vhh1
PDB Compounds: (I:) vhh1

SCOPe Domain Sequences for d5m2ii_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m2ii_ b.1.1.1 (I:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlvesggglvqaggslslscsasgrslsnyymgwfrqapgkerellgniswrgyniyyk
dsvkgrftisrddakntiylqmnrlkpedtavyycaasilplsddpgwntywgqgtqvtv
s

SCOPe Domain Coordinates for d5m2ii_:

Click to download the PDB-style file with coordinates for d5m2ii_.
(The format of our PDB-style files is described here.)

Timeline for d5m2ii_: