SCOPe 2.07: Domain d5m2jd_: 5m2j D:

Lineage for d5m2jd_ (5m2j D:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)

8. Domain d5m2jd_: 5m2j D: [338573]
   Other proteins in same PDB: d5m2ja_
   automated match to d5c3ld_

Details for d5m2jd_

PDB Entry: 5m2j, 1.9 Å

PDB Description: complex between human tnf alpha and llama vhh2

PDB Compounds: (D:) Anti-(ED-B) scFV

SCOPe Domain Sequences for d5m2jd_:

Sequence; same for both SEQRES and ATOM records:

>d5m2jd_ b.1.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvesggglvqpggslrlscaasgftfsnywmywvrqapgkglewvseintnglitky
pdsvkgrftisrdnakntlylqmnslkpedtalyycarspsgfnrgqgtqvtvss

Timeline for d5m2jd_:

• d5m2jd_ first appeared in SCOPe 2.06
  
• d5m2jd_ appears in the current release, SCOPe 2.08