Lineage for d5m8he_ (5m8h E:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2522523Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2522524Protein automated matches [190039] (158 species)
    not a true protein
  7. 2523415Species Psychrobacter arcticus [TaxId:259536] [338566] (12 PDB entries)
  8. 2523428Domain d5m8he_: 5m8h E: [338572]
    automated match to d1usyh_
    complexed with cl, mpd, sr

Details for d5m8he_

PDB Entry: 5m8h (more details), 2.34 Å

PDB Description: atp phosphoribosyltransferase (hiszg atpprt) from psychrobacter arcticus
PDB Compounds: (E:) ATP phosphoribosyltransferase

SCOPe Domain Sequences for d5m8he_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m8he_ c.94.1.0 (E:) automated matches {Psychrobacter arcticus [TaxId: 259536]}
flgltlalskgrileetmpllraagvelledpeasrklifptsnpnvrvlilrasdvpty
vehgaadfgvagkdvllehganhvyelldlkiaqcklmtagvkdaplpnrrlriatkyvn
varayfasqgqqvdviklygsmelaplvglgdlivdvvdtgntlrangleardhicdvss
rlivnqvsykrkfallepildsfknsin

SCOPe Domain Coordinates for d5m8he_:

Click to download the PDB-style file with coordinates for d5m8he_.
(The format of our PDB-style files is described here.)

Timeline for d5m8he_: