| Class b: All beta proteins [48724] (180 folds) |
| Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (2 families) ![]() |
| Family b.22.1.0: automated matches [191519] (1 protein) not a true family |
| Protein automated matches [190873] (4 species) not a true protein |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [320477] (4 PDB entries) |
| Domain d5h4cb_: 5h4c B: [338565] automated match to d4qpya_ complexed with nag |
PDB Entry: 5h4c (more details), 2.3 Å
SCOPe Domain Sequences for d5h4cb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h4cb_ b.22.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
anskvafsavrstnhepsemsnktriiyfdqilvnvgnfftlesvfvaprkgiysfsfhv
ikvyqsqtiqvnlmlngkpvisafagdkdvtreaatngvllyldkedkvylklekgnllg
gwqystfsgflvfpl
Timeline for d5h4cb_: