![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.22.1: TNF-like [49842] (2 families) ![]() |
![]() | Family b.22.1.1: TNF-like [49843] (15 proteins) |
![]() | Protein Tumor necrosis factor (TNF) [49848] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49849] (33 PDB entries) |
![]() | Domain d5m2mb_: 5m2m B: [338555] Other proteins in same PDB: d5m2md1, d5m2md2, d5m2me1, d5m2me2, d5m2mf1, d5m2mf2, d5m2mh1, d5m2mh2, d5m2mj1, d5m2mj2, d5m2mn1, d5m2mn2 automated match to d1a8ma_ |
PDB Entry: 5m2m (more details), 2.3 Å
SCOPe Domain Sequences for d5m2mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5m2mb_ b.22.1.1 (B:) Tumor necrosis factor (TNF) {Human (Homo sapiens) [TaxId: 9606]} tpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfkg qgcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfql ekgdrlsaeinrpdyldfaesgqvyfgiial
Timeline for d5m2mb_: