Lineage for d5m2mh_ (5m2m H:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2024425Species Llama (Lama glama) [TaxId:9844] [187485] (138 PDB entries)
  8. 2024632Domain d5m2mh_: 5m2m H: [338553]
    Other proteins in same PDB: d5m2ma_, d5m2mb_, d5m2mc_, d5m2mg_, d5m2mi_, d5m2mm_
    automated match to d4dkaa_

Details for d5m2mh_

PDB Entry: 5m2m (more details), 2.3 Å

PDB Description: complex between human tnf alpha and llama vhh3
PDB Compounds: (H:) Llama nanobody VHH3

SCOPe Domain Sequences for d5m2mh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m2mh_ b.1.1.1 (H:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qlqesggglvqpggslrlscaasgrtfsdhsgytytigwfrqapgkerefvariywssgn
tyyadsvkgrfaisrdiakntvdltmnnlepedtavyycaardgiptsrsvesynywgqg
tqvtvss

SCOPe Domain Coordinates for d5m2mh_:

Click to download the PDB-style file with coordinates for d5m2mh_.
(The format of our PDB-style files is described here.)

Timeline for d5m2mh_:

  • d5m2mh_ appears in periodic updates to SCOPe 2.06 starting on 2017-09-07
  • d5m2mh_ appears in the current release, SCOPe 2.07, called d5m2mh1