SCOPe 2.08: Domain d5m2mh1: 5m2m H:6-129

Lineage for d5m2mh1 (5m2m H:6-129)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d5m2mh1: 5m2m H:6-129 [338553]
   Other proteins in same PDB: d5m2ma_, d5m2mb_, d5m2mc_, d5m2md2, d5m2me2, d5m2mf2, d5m2mg_, d5m2mh2, d5m2mi_, d5m2mj2, d5m2mm_, d5m2mn2
   automated match to d4dkaa_

Details for d5m2mh1

PDB Entry: 5m2m, 2.3 Å

PDB Description: complex between human tnf alpha and llama vhh3

PDB Compounds: (H:) Llama nanobody VHH3

SCOPe Domain Sequences for d5m2mh1:

Sequence; same for both SEQRES and ATOM records:

>d5m2mh1 b.1.1.1 (H:6-129) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqpggslrlscaasgrtfsdhsgytytigwfrqapgkerefvariywssgntyy
adsvkgrfaisrdiakntvdltmnnlepedtavyycaardgiptsrsvesynywgqgtqv
tvss

Timeline for d5m2mh1:

• d5m2mh1 first appeared in SCOPe 2.06, called d5m2mh_
  
• d5m2mh1 appears in SCOPe 2.07