SCOPe 2.06: Domain d5m0yb2: 5m0y B:103-164

Lineage for d5m0yb2 (5m0y B:103-164)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.139: Type I dockerin domain [63445] (1 superfamily)
   tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand

4. Superfamily a.139.1: Type I dockerin domain [63446] (2 families)

5. Family a.139.1.0: automated matches [191542] (1 protein)
   not a true family

6. Protein automated matches [190928] (7 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:203119] [194257] (4 PDB entries)

8. Domain d5m0yb2: 5m0y B:103-164 [338550]
   Other proteins in same PDB: d5m0ya1, d5m0ya2, d5m0yb1
   automated match to d4u3sb2
   complexed with ca, edo, gol, p6g, pge, so4

Details for d5m0yb2

PDB Entry: 5m0y, 1.5 Å

PDB Description: crystal structure of the cohscaa-xdoccipb type ii complex from clostridium thermocellum at 1.5angstrom resolution

PDB Compounds: (B:) Ig domain protein group 2 domain protein

SCOPe Domain Sequences for d5m0yb2:

Sequence; same for both SEQRES and ATOM records:

>d5m0yb2 a.139.1.0 (B:103-164) automated matches {Clostridium thermocellum [TaxId: 203119]}
erkgvqdnainmvdvmeiskvfgtragdeeyvaeldlnmdgainlfdiaivirhfnalps
ry

Timeline for d5m0yb2:

• d5m0yb2 is new in SCOPe 2.06-stable
  
• d5m0yb2 appears in SCOPe 2.07
  
• d5m0yb2 appears in the current release, SCOPe 2.08