Lineage for d5m0yb2 (5m0y B:103-164)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734507Fold a.139: Type I dockerin domain [63445] (1 superfamily)
    tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand
  4. 2734508Superfamily a.139.1: Type I dockerin domain [63446] (2 families) (S)
  5. 2734526Family a.139.1.0: automated matches [191542] (1 protein)
    not a true family
  6. 2734527Protein automated matches [190928] (7 species)
    not a true protein
  7. 2734551Species Clostridium thermocellum [TaxId:203119] [194257] (4 PDB entries)
  8. 2734554Domain d5m0yb2: 5m0y B:103-164 [338550]
    Other proteins in same PDB: d5m0ya1, d5m0ya2, d5m0yb1
    automated match to d4u3sb2
    complexed with ca, edo, gol, p6g, pge, so4

Details for d5m0yb2

PDB Entry: 5m0y (more details), 1.5 Å

PDB Description: crystal structure of the cohscaa-xdoccipb type ii complex from clostridium thermocellum at 1.5angstrom resolution
PDB Compounds: (B:) Ig domain protein group 2 domain protein

SCOPe Domain Sequences for d5m0yb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m0yb2 a.139.1.0 (B:103-164) automated matches {Clostridium thermocellum [TaxId: 203119]}
erkgvqdnainmvdvmeiskvfgtragdeeyvaeldlnmdgainlfdiaivirhfnalps
ry

SCOPe Domain Coordinates for d5m0yb2:

Click to download the PDB-style file with coordinates for d5m0yb2.
(The format of our PDB-style files is described here.)

Timeline for d5m0yb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5m0yb1