Lineage for d5m0yb1 (5m0y B:8-102)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2041484Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2041638Superfamily b.3.2: Carboxypeptidase regulatory domain-like [49464] (3 families) (S)
  5. 2041654Family b.3.2.0: automated matches [275446] (1 protein)
    not a true family
  6. 2041655Protein automated matches [275447] (3 species)
    not a true protein
  7. 2041661Species Clostridium thermocellum [TaxId:203119] [338548] (1 PDB entry)
  8. 2041662Domain d5m0yb1: 5m0y B:8-102 [338549]
    Other proteins in same PDB: d5m0ya1, d5m0ya2, d5m0yb2
    automated match to d4u3sb1
    complexed with ca, edo, gol, p6g, pge, so4

Details for d5m0yb1

PDB Entry: 5m0y (more details), 1.5 Å

PDB Description: crystal structure of the cohscaa-xdoccipb type ii complex from clostridium thermocellum at 1.5angstrom resolution
PDB Compounds: (B:) Ig domain protein group 2 domain protein

SCOPe Domain Sequences for d5m0yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m0yb1 b.3.2.0 (B:8-102) automated matches {Clostridium thermocellum [TaxId: 203119]}
kttvsgyisvdfdyppeseskiksgfnvkvagtelstktdekgyfeisgipgdmreftle
iskrnylkrnvtvngtgklvvstednplilwagdv

SCOPe Domain Coordinates for d5m0yb1:

Click to download the PDB-style file with coordinates for d5m0yb1.
(The format of our PDB-style files is described here.)

Timeline for d5m0yb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5m0yb2