![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.2: Carboxypeptidase regulatory domain-like [49464] (3 families) ![]() |
![]() | Family b.3.2.0: automated matches [275446] (1 protein) not a true family |
![]() | Protein automated matches [275447] (3 species) not a true protein |
![]() | Species Clostridium thermocellum [TaxId:203119] [338548] (1 PDB entry) |
![]() | Domain d5m0yb1: 5m0y B:8-102 [338549] Other proteins in same PDB: d5m0ya1, d5m0ya2, d5m0yb2 automated match to d4u3sb1 complexed with ca, edo, gol, p6g, pge, so4 |
PDB Entry: 5m0y (more details), 1.5 Å
SCOPe Domain Sequences for d5m0yb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5m0yb1 b.3.2.0 (B:8-102) automated matches {Clostridium thermocellum [TaxId: 203119]} kttvsgyisvdfdyppeseskiksgfnvkvagtelstktdekgyfeisgipgdmreftle iskrnylkrnvtvngtgklvvstednplilwagdv
Timeline for d5m0yb1: