SCOPe 2.08: Domain d5m0yb1: 5m0y B:8-102

Lineage for d5m0yb1 (5m0y B:8-102)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.2: Carboxypeptidase regulatory domain-like [49464] (3 families)

5. Family b.3.2.0: automated matches [275446] (1 protein)
   not a true family

6. Protein automated matches [275447] (3 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:203119] [338548] (1 PDB entry)

8. Domain d5m0yb1: 5m0y B:8-102 [338549]
   Other proteins in same PDB: d5m0ya1, d5m0ya2, d5m0yb2
   automated match to d4u3sb1
   complexed with ca, edo, gol, p6g, pge, so4

Details for d5m0yb1

PDB Entry: 5m0y, 1.5 Å

PDB Description: crystal structure of the cohscaa-xdoccipb type ii complex from clostridium thermocellum at 1.5angstrom resolution

PDB Compounds: (B:) Ig domain protein group 2 domain protein

SCOPe Domain Sequences for d5m0yb1:

Sequence; same for both SEQRES and ATOM records:

>d5m0yb1 b.3.2.0 (B:8-102) automated matches {Clostridium thermocellum [TaxId: 203119]}
kttvsgyisvdfdyppeseskiksgfnvkvagtelstktdekgyfeisgipgdmreftle
iskrnylkrnvtvngtgklvvstednplilwagdv

Timeline for d5m0yb1:

• d5m0yb1 first appeared in SCOPe 2.06
  
• d5m0yb1 appears in SCOPe 2.07