Lineage for d5m0ya1 (5m0y A:16-188)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2040316Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2040342Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 2040356Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
    Pfam PF00963
  6. 2040439Protein automated matches [190248] (6 species)
    not a true protein
  7. 2040453Species Clostridium thermocellum [TaxId:203119] [189219] (2 PDB entries)
  8. 2040454Domain d5m0ya1: 5m0y A:16-188 [338546]
    Other proteins in same PDB: d5m0ya2, d5m0yb1, d5m0yb2
    automated match to d2b59a1
    complexed with ca, edo, gol, p6g, pge, so4

Details for d5m0ya1

PDB Entry: 5m0y (more details), 1.5 Å

PDB Description: crystal structure of the cohscaa-xdoccipb type ii complex from clostridium thermocellum at 1.5angstrom resolution
PDB Compounds: (A:) Cellulosome anchoring protein cohesin region

SCOPe Domain Sequences for d5m0ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m0ya1 b.2.2.2 (A:16-188) automated matches {Clostridium thermocellum [TaxId: 203119]}
dkassielkfdrnkgevgdiligtvrinniknfagfqvnivydpkvlmavdpetgkefts
stfppgrtvlknnaygpiqiadndpekgilnfalaysyiagyketgvteesgiiakigfk
ilqkkstavkfqdtlsmpgailgtqlfdwdgevitgyeviqpdvlslgdepye

SCOPe Domain Coordinates for d5m0ya1:

Click to download the PDB-style file with coordinates for d5m0ya1.
(The format of our PDB-style files is described here.)

Timeline for d5m0ya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5m0ya2