SCOPe 2.08: Domain d5m0ya1: 5m0y A:16-188

Lineage for d5m0ya1 (5m0y A:16-188)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
   Pfam PF00963

6. Protein automated matches [190248] (6 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:203119] [189219] (2 PDB entries)

8. Domain d5m0ya1: 5m0y A:16-188 [338546]
   Other proteins in same PDB: d5m0ya2, d5m0yb1, d5m0yb2
   automated match to d2b59a1
   complexed with ca, edo, gol, p6g, pge, so4

Details for d5m0ya1

PDB Entry: 5m0y, 1.5 Å

PDB Description: crystal structure of the cohscaa-xdoccipb type ii complex from clostridium thermocellum at 1.5angstrom resolution

PDB Compounds: (A:) Cellulosome anchoring protein cohesin region

SCOPe Domain Sequences for d5m0ya1:

Sequence; same for both SEQRES and ATOM records:

>d5m0ya1 b.2.2.2 (A:16-188) automated matches {Clostridium thermocellum [TaxId: 203119]}
dkassielkfdrnkgevgdiligtvrinniknfagfqvnivydpkvlmavdpetgkefts
stfppgrtvlknnaygpiqiadndpekgilnfalaysyiagyketgvteesgiiakigfk
ilqkkstavkfqdtlsmpgailgtqlfdwdgevitgyeviqpdvlslgdepye

Timeline for d5m0ya1:

• d5m0ya1 first appeared in SCOPe 2.06
  
• d5m0ya1 appears in SCOPe 2.07