Class b: All beta proteins [48724] (180 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) |
Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins) Pfam PF00963 |
Protein automated matches [190248] (6 species) not a true protein |
Species Clostridium thermocellum [TaxId:203119] [189219] (2 PDB entries) |
Domain d5m0ya1: 5m0y A:16-188 [338546] Other proteins in same PDB: d5m0ya2, d5m0yb1, d5m0yb2 automated match to d2b59a1 complexed with ca, edo, gol, p6g, pge, so4 |
PDB Entry: 5m0y (more details), 1.5 Å
SCOPe Domain Sequences for d5m0ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5m0ya1 b.2.2.2 (A:16-188) automated matches {Clostridium thermocellum [TaxId: 203119]} dkassielkfdrnkgevgdiligtvrinniknfagfqvnivydpkvlmavdpetgkefts stfppgrtvlknnaygpiqiadndpekgilnfalaysyiagyketgvteesgiiakigfk ilqkkstavkfqdtlsmpgailgtqlfdwdgevitgyeviqpdvlslgdepye
Timeline for d5m0ya1: