Lineage for d5m2me_ (5m2m E:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2024425Species Llama (Lama glama) [TaxId:9844] [187485] (138 PDB entries)
  8. 2024630Domain d5m2me_: 5m2m E: [338543]
    Other proteins in same PDB: d5m2ma_, d5m2mb_, d5m2mc_, d5m2mg_, d5m2mi_, d5m2mm_
    automated match to d4dkaa_

Details for d5m2me_

PDB Entry: 5m2m (more details), 2.3 Å

PDB Description: complex between human tnf alpha and llama vhh3
PDB Compounds: (E:) Llama nanobody VHH3

SCOPe Domain Sequences for d5m2me_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m2me_ b.1.1.1 (E:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qlqesggglvqpggslrlscaasgrtfsdhsgytytigwfrqapgkerefvariywssgn
tyyadsvkgrfaisrdiakntvdltmnnlepedtavyycaardgiptsrsvesynywgqg
tqvtvss

SCOPe Domain Coordinates for d5m2me_:

Click to download the PDB-style file with coordinates for d5m2me_.
(The format of our PDB-style files is described here.)

Timeline for d5m2me_:

  • d5m2me_ appears in the current release, SCOPe 2.07, called d5m2me1