Lineage for d5m2me1 (5m2m E:6-129)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2744011Domain d5m2me1: 5m2m E:6-129 [338543]
    Other proteins in same PDB: d5m2ma_, d5m2mb_, d5m2mc_, d5m2md2, d5m2me2, d5m2mf2, d5m2mg_, d5m2mh2, d5m2mi_, d5m2mj2, d5m2mm_, d5m2mn2
    automated match to d4dkaa_

Details for d5m2me1

PDB Entry: 5m2m (more details), 2.3 Å

PDB Description: complex between human tnf alpha and llama vhh3
PDB Compounds: (E:) Llama nanobody VHH3

SCOPe Domain Sequences for d5m2me1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m2me1 b.1.1.1 (E:6-129) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqpggslrlscaasgrtfsdhsgytytigwfrqapgkerefvariywssgntyy
adsvkgrfaisrdiakntvdltmnnlepedtavyycaardgiptsrsvesynywgqgtqv
tvss

SCOPe Domain Coordinates for d5m2me1:

Click to download the PDB-style file with coordinates for d5m2me1.
(The format of our PDB-style files is described here.)

Timeline for d5m2me1: