Lineage for d5lpoa_ (5lpo A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2425361Superfamily c.1.20: tRNA-guanine transglycosylase [51713] (1 family) (S)
  5. 2425362Family c.1.20.1: tRNA-guanine transglycosylase [51714] (2 protein domains)
  6. 2425373Protein Queosine tRNA-guanine transglycosylase [51715] (3 species)
    contains zinc-binding subdomain
  7. 2425402Species Zymomonas mobilis [TaxId:542] [51716] (116 PDB entries)
    Uniprot P28720
  8. 2425462Domain d5lpoa_: 5lpo A: [338532]
    automated match to d1q2ra_
    protein/RNA complex; complexed with 725, edo, gol, pg4, zn

Details for d5lpoa_

PDB Entry: 5lpo (more details), 1.42 Å

PDB Description: trna guanine transglycosylase (tgt) in co-crystallized complex with 6- amino-2-(methylamino)-4-(2-((2r,3r,4r,5r)-3,4,5- trimethoxytetrahydrofuran-2-yl)ethyl)-1h-imidazo[4,5-g]quinazolin- 8(7h)-one
PDB Compounds: (A:) Queuine tRNA-ribosyltransferase

SCOPe Domain Sequences for d5lpoa_:

Sequence, based on SEQRES records: (download)

>d5lpoa_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]}
drprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilg
ntyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshld
gsrhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsr
keqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvp
mlpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfse
dlkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegr
fsqfaqdfraryfa

Sequence, based on observed residues (ATOM records): (download)

>d5lpoa_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]}
drprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkaadiilgntyhlmlrpg
aeriaklgglhsfmgwdrpiltdsggyqvmslstkqseegvtfkshldgsrhmlspersi
eiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrkeqaenaalfgi
qqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpmlpddkphylmg
vgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsedlkpldsechca
vcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrfsqfaqdfrary
fa

SCOPe Domain Coordinates for d5lpoa_:

Click to download the PDB-style file with coordinates for d5lpoa_.
(The format of our PDB-style files is described here.)

Timeline for d5lpoa_: