SCOPe 2.07: Domain d5lr0b2: 5lr0 B:1077-1284

Lineage for d5lr0b2 (5lr0 B:1077-1284)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.4: STI-like [50386] (3 families)

5. Family b.42.4.0: automated matches [191368] (1 protein)
   not a true family

6. Protein automated matches [190445] (10 species)
   not a true protein

7. Species Clostridium botulinum [TaxId:1491] [225676] (22 PDB entries)

8. Domain d5lr0b2: 5lr0 B:1077-1284 [338527]
   Other proteins in same PDB: d5lr0a1, d5lr0b1
   automated match to d3n7ma2
   complexed with gal, nga, sia

Details for d5lr0b2

PDB Entry: 5lr0, 2.59 Å

PDB Description: binding domain of botulinum neurotoxin dc in complex with sialylt

PDB Compounds: (B:) Botulinum neurotoxin D/C protein

SCOPe Domain Sequences for d5lr0b2:

Sequence; same for both SEQRES and ATOM records:

>d5lr0b2 b.42.4.0 (B:1077-1284) automated matches {Clostridium botulinum [TaxId: 1491]}
ddkdinilfnslqytnvvkdywgndlrydkeyyminvnymnrymskkgngivfntrknnn
dfnegykiiikrirgntndtrvrgenvlyfnttidnkqyslgmykpsrnlgtdlvplgal
dqpmdeirkygsfiiqpcntfdyyasqlflssnattnrlgilsigsysfklgddywfnhe
ylipvikiehyaslleststhwvfvpas

Timeline for d5lr0b2:

• d5lr0b2 first appeared in SCOPe 2.06
  
• d5lr0b2 appears in the current release, SCOPe 2.08