Lineage for d5lr0b2 (5lr0 B:1077-1284)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2792430Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2792578Family b.42.4.0: automated matches [191368] (1 protein)
    not a true family
  6. 2792579Protein automated matches [190445] (12 species)
    not a true protein
  7. 2792592Species Clostridium botulinum [TaxId:1491] [225676] (22 PDB entries)
  8. 2792611Domain d5lr0b2: 5lr0 B:1077-1284 [338527]
    Other proteins in same PDB: d5lr0a1, d5lr0b1
    automated match to d3n7ma2
    complexed with sia

Details for d5lr0b2

PDB Entry: 5lr0 (more details), 2.59 Å

PDB Description: binding domain of botulinum neurotoxin dc in complex with sialylt
PDB Compounds: (B:) Botulinum neurotoxin D/C protein

SCOPe Domain Sequences for d5lr0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lr0b2 b.42.4.0 (B:1077-1284) automated matches {Clostridium botulinum [TaxId: 1491]}
ddkdinilfnslqytnvvkdywgndlrydkeyyminvnymnrymskkgngivfntrknnn
dfnegykiiikrirgntndtrvrgenvlyfnttidnkqyslgmykpsrnlgtdlvplgal
dqpmdeirkygsfiiqpcntfdyyasqlflssnattnrlgilsigsysfklgddywfnhe
ylipvikiehyaslleststhwvfvpas

SCOPe Domain Coordinates for d5lr0b2:

Click to download the PDB-style file with coordinates for d5lr0b2.
(The format of our PDB-style files is described here.)

Timeline for d5lr0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5lr0b1