![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.4: STI-like [50386] (3 families) ![]() |
![]() | Family b.42.4.0: automated matches [191368] (1 protein) not a true family |
![]() | Protein automated matches [190445] (12 species) not a true protein |
![]() | Species Clostridium botulinum [TaxId:1491] [225676] (22 PDB entries) |
![]() | Domain d5lr0b2: 5lr0 B:1077-1284 [338527] Other proteins in same PDB: d5lr0a1, d5lr0b1 automated match to d3n7ma2 complexed with sia |
PDB Entry: 5lr0 (more details), 2.59 Å
SCOPe Domain Sequences for d5lr0b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lr0b2 b.42.4.0 (B:1077-1284) automated matches {Clostridium botulinum [TaxId: 1491]} ddkdinilfnslqytnvvkdywgndlrydkeyyminvnymnrymskkgngivfntrknnn dfnegykiiikrirgntndtrvrgenvlyfnttidnkqyslgmykpsrnlgtdlvplgal dqpmdeirkygsfiiqpcntfdyyasqlflssnattnrlgilsigsysfklgddywfnhe ylipvikiehyaslleststhwvfvpas
Timeline for d5lr0b2: