SCOPe 2.07: Domain d5lr0b1: 5lr0 B:863-1076

Lineage for d5lr0b1 (5lr0 B:863-1076)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (66 species)
   not a true protein

7. Species Clostridium botulinum [TaxId:1491] [225675] (24 PDB entries)

8. Domain d5lr0b1: 5lr0 B:863-1076 [338526]
   Other proteins in same PDB: d5lr0a2, d5lr0b2
   automated match to d3n7la1
   complexed with gal, nga, sia

Details for d5lr0b1

PDB Entry: 5lr0, 2.59 Å

PDB Description: binding domain of botulinum neurotoxin dc in complex with sialylt

PDB Compounds: (B:) Botulinum neurotoxin D/C protein

SCOPe Domain Sequences for d5lr0b1:

Sequence, based on SEQRES records:

>d5lr0b1 b.29.1.0 (B:863-1076) automated matches {Clostridium botulinum [TaxId: 1491]}
sindskilslqnkkntlmdtsgynaevrvegnvqlnpifpfdfklgssgddrgkvivtqn
enivynamyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkqnen
seqdinfsydisknaagynkwffvtittnmmgnmmiyingklidtikvkeltginfskti
tfqmnkipntglitsdsdninmwirdfyifakel

Sequence, based on observed residues (ATOM records):

>d5lr0b1 b.29.1.0 (B:863-1076) automated matches {Clostridium botulinum [TaxId: 1491]}
sindskilslqnkkntlmdtsgynaevrvegnvqlnpifpfdfklgssgddrgkvivtqn
enivynamyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkqnen
seqdinfsydisknaagynkwffvtittnmmgnmmiyingklidtikvkeltginfskti
tfqmnkidninmwirdfyifakel

Timeline for d5lr0b1:

• d5lr0b1 first appeared in SCOPe 2.06
  
• d5lr0b1 appears in the current release, SCOPe 2.08