Lineage for d5lr0b1 (5lr0 B:863-1076)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2780769Species Clostridium botulinum [TaxId:1491] [225675] (24 PDB entries)
  8. 2780792Domain d5lr0b1: 5lr0 B:863-1076 [338526]
    Other proteins in same PDB: d5lr0a2, d5lr0b2
    automated match to d3n7la1
    complexed with sia

Details for d5lr0b1

PDB Entry: 5lr0 (more details), 2.59 Å

PDB Description: binding domain of botulinum neurotoxin dc in complex with sialylt
PDB Compounds: (B:) Botulinum neurotoxin D/C protein

SCOPe Domain Sequences for d5lr0b1:

Sequence, based on SEQRES records: (download)

>d5lr0b1 b.29.1.0 (B:863-1076) automated matches {Clostridium botulinum [TaxId: 1491]}
sindskilslqnkkntlmdtsgynaevrvegnvqlnpifpfdfklgssgddrgkvivtqn
enivynamyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkqnen
seqdinfsydisknaagynkwffvtittnmmgnmmiyingklidtikvkeltginfskti
tfqmnkipntglitsdsdninmwirdfyifakel

Sequence, based on observed residues (ATOM records): (download)

>d5lr0b1 b.29.1.0 (B:863-1076) automated matches {Clostridium botulinum [TaxId: 1491]}
sindskilslqnkkntlmdtsgynaevrvegnvqlnpifpfdfklgssgddrgkvivtqn
enivynamyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkqnen
seqdinfsydisknaagynkwffvtittnmmgnmmiyingklidtikvkeltginfskti
tfqmnkidninmwirdfyifakel

SCOPe Domain Coordinates for d5lr0b1:

Click to download the PDB-style file with coordinates for d5lr0b1.
(The format of our PDB-style files is described here.)

Timeline for d5lr0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5lr0b2