SCOPe 2.07: Domain d5k65b2: 5k65 B:340-445

Lineage for d5k65b2 (5k65 B:340-445)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d5k65b2: 5k65 B:340-445 [338522]
   Other proteins in same PDB: d5k65a1, d5k65b1
   automated match to d1hzhh4
   complexed with bma, fuc, man, nag

Details for d5k65b2

PDB Entry: 5k65, 2.5 Å

PDB Description: crystal structure of vegf binding igg1-fc (fcab ct6)

PDB Compounds: (B:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d5k65b2:

Sequence; same for both SEQRES and ATOM records:

>d5k65b2 b.1.1.0 (B:340-445) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgqprepqvytlppsrdelrfyqvsltclvkgfypsdiavewesngqpdifpnglnyktt
ppvldsdgsfflyskltvpypswlmgtrfscsvmhealhnhytqkhleyqw

Timeline for d5k65b2:

• d5k65b2 first appeared in SCOPe 2.06
  
• d5k65b2 appears in the current release, SCOPe 2.08