Lineage for d1de4i3 (1de4 I:122-189,I:383-608)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889494Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2889859Family c.56.5.5: FolH catalytic domain-like [53210] (2 proteins)
  6. 2889899Protein Transferrin receptor ectodomain, protease-like domain [53211] (1 species)
  7. 2889900Species Human (Homo sapiens) [TaxId:9606] [53212] (4 PDB entries)
  8. 2889904Domain d1de4i3: 1de4 I:122-189,I:383-608 [33850]
    Other proteins in same PDB: d1de4a1, d1de4a2, d1de4b_, d1de4c1, d1de4c2, d1de4d1, d1de4d2, d1de4e_, d1de4f1, d1de4f2, d1de4g1, d1de4g2, d1de4h_, d1de4i1, d1de4i2
    complexed with ca, gol, nag

Details for d1de4i3

PDB Entry: 1de4 (more details), 2.8 Å

PDB Description: hemochromatosis protein hfe complexed with transferrin receptor
PDB Compounds: (I:) transferrin receptor

SCOPe Domain Sequences for d1de4i3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1de4i3 c.56.5.5 (I:122-189,I:383-608) Transferrin receptor ectodomain, protease-like domain {Human (Homo sapiens) [TaxId: 9606]}
lywddlkrklsekldstdftstikllnensyvpreagsqkdenlalyvenqfrefklskv
wrdqhfvkXeikilnifgvikgfvepdhyvvvgaqrdawgpgaaksgvgtalllklaqmf
sdmvlkdgfqpsrsiifaswsagdfgsvgatewlegylsslhlkaftyinldkavlgtsn
fkvsaspllytliektmqnvkhpvtgqflyqdsnwaskvekltldnaafpflaysgipav
sfcfcedtdypylgttmdtykelieripelnkvaraaaevagqfviklthdveln

SCOPe Domain Coordinates for d1de4i3:

Click to download the PDB-style file with coordinates for d1de4i3.
(The format of our PDB-style files is described here.)

Timeline for d1de4i3: