![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.22.1: TNF-like [49842] (2 families) ![]() |
![]() | Family b.22.1.0: automated matches [191519] (1 protein) not a true family |
![]() | Protein automated matches [190873] (4 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [320477] (4 PDB entries) |
![]() | Domain d5h4cc_: 5h4c C: [338495] automated match to d4qpya_ complexed with nag |
PDB Entry: 5h4c (more details), 2.3 Å
SCOPe Domain Sequences for d5h4cc_:
Sequence, based on SEQRES records: (download)
>d5h4cc_ b.22.1.0 (C:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} anskvafsavrstnhepsemsnktriiyfdqilvnvgnfftlesvfvaprkgiysfsfhv ikvyqsqtiqvnlmlngkpvisafagdkdvtreaatngvllyldkedkvylklekgnllg gwqystfsgflvfpl
>d5h4cc_ b.22.1.0 (C:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} anskvafsavrstnhemsnktriiyfdqilvnvgnfftlesvfvaprkgiysfsfhvikv yqsqtiqvnlmlngkpvisafagdkdvtreaatngvllyldkedkvylklekgnllggwq ystfsgflvfpl
Timeline for d5h4cc_: