![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.82.1: ALDH-like [53720] (3 families) ![]() binds NAD differently from other NAD(P)-dependent oxidoreductases |
![]() | Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
![]() | Protein automated matches [190683] (61 species) not a true protein |
![]() | Species Bacillus cereus [TaxId:526980] [269753] (4 PDB entries) |
![]() | Domain d5gtla_: 5gtl A: [338482] automated match to d4qetb_ complexed with na, ndp |
PDB Entry: 5gtl (more details), 2 Å
SCOPe Domain Sequences for d5gtla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gtla_ c.82.1.0 (A:) automated matches {Bacillus cereus [TaxId: 526980]} tnielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedidaav kaarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvaldddisa tvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmgaala tgctivlkpaeqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkvaft gstvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqncsag srvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkkega tvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierannssy glaagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyaldny tevksvwvnik
Timeline for d5gtla_: